Description
Product Description
Protein Description: karyopherin alpha 1 (importin alpha 5)
Gene Name: KPNA1
Alternative Gene Name: IPOA5, NPI-1, RCH2, SRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022905: 97%, ENSRNOG00000051711: 97%
Entrez Gene ID: 3836
Uniprot ID: P52294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KPNA1
Alternative Gene Name: IPOA5, NPI-1, RCH2, SRP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000022905: 97%, ENSRNOG00000051711: 97%
Entrez Gene ID: 3836
Uniprot ID: P52294
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
| Product Specifications | |
| Application | WB, ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Immunogen | LFKRRNVATAEEETEEEVMSDGGFHEAQISNM |
| Gene Sequence | LFKRRNVATAEEETEEEVMSDGGFHEAQISNM |
| Gene ID - Mouse | ENSMUSG00000022905 |
| Gene ID - Rat | ENSRNOG00000051711 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
| Documents & Links for Anti KPNA1 pAb (ATL-HPA063426) | |
| Datasheet | Anti KPNA1 pAb (ATL-HPA063426) Datasheet (External Link) |
| Vendor Page | Anti KPNA1 pAb (ATL-HPA063426) at Atlas Antibodies |
| Documents & Links for Anti KPNA1 pAb (ATL-HPA063426) | |
| Datasheet | Anti KPNA1 pAb (ATL-HPA063426) Datasheet (External Link) |
| Vendor Page | Anti KPNA1 pAb (ATL-HPA063426) |