Description
Product Description
Protein Description: lysine-rich nucleolar protein 1
Gene Name: KNOP1
Alternative Gene Name: 101F10.1, C16orf88, FAM191A, TSG118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030980: 71%, ENSRNOG00000046147: 86%
Entrez Gene ID: 400506
Uniprot ID: Q1ED39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KNOP1
Alternative Gene Name: 101F10.1, C16orf88, FAM191A, TSG118
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030980: 71%, ENSRNOG00000046147: 86%
Entrez Gene ID: 400506
Uniprot ID: Q1ED39
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT |
Gene Sequence | KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT |
Gene ID - Mouse | ENSMUSG00000030980 |
Gene ID - Rat | ENSRNOG00000046147 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KNOP1 pAb (ATL-HPA066169) | |
Datasheet | Anti KNOP1 pAb (ATL-HPA066169) Datasheet (External Link) |
Vendor Page | Anti KNOP1 pAb (ATL-HPA066169) at Atlas Antibodies |
Documents & Links for Anti KNOP1 pAb (ATL-HPA066169) | |
Datasheet | Anti KNOP1 pAb (ATL-HPA066169) Datasheet (External Link) |
Vendor Page | Anti KNOP1 pAb (ATL-HPA066169) |