Protein Description: lysine methyltransferase 5B
Gene Name: KMT5B
Alternative Gene Name: CGI-85, SUV420H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045098: 86%, ENSRNOG00000016790: 87%
Entrez Gene ID: 51111
Uniprot ID: Q4FZB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KMT5B
Alternative Gene Name: CGI-85, SUV420H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045098: 86%, ENSRNOG00000016790: 87%
Entrez Gene ID: 51111
Uniprot ID: Q4FZB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR |
| Documents & Links for Anti KMT5B pAb (ATL-HPA063648) | |
| Datasheet | Anti KMT5B pAb (ATL-HPA063648) Datasheet (External Link) |
| Vendor Page | Anti KMT5B pAb (ATL-HPA063648) at Atlas |
| Documents & Links for Anti KMT5B pAb (ATL-HPA063648) | |
| Datasheet | Anti KMT5B pAb (ATL-HPA063648) Datasheet (External Link) |
| Vendor Page | Anti KMT5B pAb (ATL-HPA063648) |