Anti KMT5B pAb (ATL-HPA063648)

Atlas Antibodies

Catalog No: ATL-HPA063648-25

• 

Product Description

Protein Description: lysine methyltransferase 5B
Gene Name: KMT5B
Alternative Gene Name: CGI-85, SUV420H1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000045098: 86%, ENSRNOG00000016790: 87%
Entrez Gene ID: 51111
Uniprot ID: Q4FZB7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
• Gene Sequence: DQGEHSGTVGVPVSYTDCAPSPVGCSVVTSDSFKTKDSFRTAKSKKKRRITRYDAQLILENNSGIPKLTLR
• Gene ID - Mouse: ENSMUSG00000045098
• Gene ID - Rat: ENSRNOG00000016790
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.