Protein Description: lysine methyltransferase 5A
Gene Name: KMT5A
Alternative Gene Name: PR-Set7, SET07, SET8, SETD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049327: 90%, ENSRNOG00000001062: 88%
Entrez Gene ID: 387893
Uniprot ID: Q9NQR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KMT5A
Alternative Gene Name: PR-Set7, SET07, SET8, SETD8
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000049327: 90%, ENSRNOG00000001062: 88%
Entrez Gene ID: 387893
Uniprot ID: Q9NQR1
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | KDARKGPLVPFPNQKSEAAEPPKTPPSSCDSTNAAIAKQALKKPIKGKQAPRKKAQGKTQQNRKLTDFYPVRRSSRKSKAELQSEERKRIDELIESGK |
Documents & Links for Anti KMT5A pAb (ATL-HPA064495) | |
Datasheet | Anti KMT5A pAb (ATL-HPA064495) Datasheet (External Link) |
Vendor Page | Anti KMT5A pAb (ATL-HPA064495) at Atlas |
Documents & Links for Anti KMT5A pAb (ATL-HPA064495) | |
Datasheet | Anti KMT5A pAb (ATL-HPA064495) Datasheet (External Link) |
Vendor Page | Anti KMT5A pAb (ATL-HPA064495) |