Protein Description: lysine (K)-specific methyltransferase 2C
Gene Name: KMT2C
Alternative Gene Name: HALR, KIAA1506, MLL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038056: 88%, ENSRNOG00000006718: 33%
Entrez Gene ID: 58508
Uniprot ID: Q8NEZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KMT2C
Alternative Gene Name: HALR, KIAA1506, MLL3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038056: 88%, ENSRNOG00000006718: 33%
Entrez Gene ID: 58508
Uniprot ID: Q8NEZ4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | TPPTMSQPTFPMVPQQLQHQQHTTVISGHTSPVRMPSLPGWQPNSAPAHLPLNPPRIQPPIAQLPIKTCTPAPGTVSNANPQ |
Documents & Links for Anti KMT2C pAb (ATL-HPA074736) | |
Datasheet | Anti KMT2C pAb (ATL-HPA074736) Datasheet (External Link) |
Vendor Page | Anti KMT2C pAb (ATL-HPA074736) at Atlas |
Documents & Links for Anti KMT2C pAb (ATL-HPA074736) | |
Datasheet | Anti KMT2C pAb (ATL-HPA074736) Datasheet (External Link) |
Vendor Page | Anti KMT2C pAb (ATL-HPA074736) |