Description
Product Description
Protein Description: killer cell lectin-like receptor subfamily G, member 1
Gene Name: KLRG1
Alternative Gene Name: 2F1, CLEC15A, MAFA, MAFA-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030114: 57%, ENSRNOG00000050763: 52%
Entrez Gene ID: 10219
Uniprot ID: Q96E93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLRG1
Alternative Gene Name: 2F1, CLEC15A, MAFA, MAFA-L
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030114: 57%, ENSRNOG00000050763: 52%
Entrez Gene ID: 10219
Uniprot ID: Q96E93
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE |
Gene Sequence | LCQGSNYSTCASCPSCPDRWMKYGNHCYYFSVEEKDWNSSLEFCLARDSHLLVITDNQEMSLLQVFLSE |
Gene ID - Mouse | ENSMUSG00000030114 |
Gene ID - Rat | ENSRNOG00000050763 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KLRG1 pAb (ATL-HPA076494) | |
Datasheet | Anti KLRG1 pAb (ATL-HPA076494) Datasheet (External Link) |
Vendor Page | Anti KLRG1 pAb (ATL-HPA076494) at Atlas Antibodies |
Documents & Links for Anti KLRG1 pAb (ATL-HPA076494) | |
Datasheet | Anti KLRG1 pAb (ATL-HPA076494) Datasheet (External Link) |
Vendor Page | Anti KLRG1 pAb (ATL-HPA076494) |