Description
Product Description
Protein Description: killer cell lectin-like receptor subfamily D, member 1
Gene Name: KLRD1
Alternative Gene Name: CD94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030165: 51%, ENSRNOG00000060246: 52%
Entrez Gene ID: 3824
Uniprot ID: Q13241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLRD1
Alternative Gene Name: CD94
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030165: 51%, ENSRNOG00000060246: 52%
Entrez Gene ID: 3824
Uniprot ID: Q13241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA |
Gene Sequence | IEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNA |
Gene ID - Mouse | ENSMUSG00000030165 |
Gene ID - Rat | ENSRNOG00000060246 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KLRD1 pAb (ATL-HPA069688) | |
Datasheet | Anti KLRD1 pAb (ATL-HPA069688) Datasheet (External Link) |
Vendor Page | Anti KLRD1 pAb (ATL-HPA069688) at Atlas Antibodies |
Documents & Links for Anti KLRD1 pAb (ATL-HPA069688) | |
Datasheet | Anti KLRD1 pAb (ATL-HPA069688) Datasheet (External Link) |
Vendor Page | Anti KLRD1 pAb (ATL-HPA069688) |