Protein Description: killin, p53-regulated DNA replication inhibitor
Gene Name: KLLN
Alternative Gene Name: killin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015468: 27%, ENSRNOG00000019964: 29%
Entrez Gene ID: 100144748
Uniprot ID: B2CW77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLLN
Alternative Gene Name: killin
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000015468: 27%, ENSRNOG00000019964: 29%
Entrez Gene ID: 100144748
Uniprot ID: B2CW77
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSSFARGALAWCRQRNPNPSCAAAETGARTSLPKERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLL |
Documents & Links for Anti KLLN pAb (ATL-HPA074502) | |
Datasheet | Anti KLLN pAb (ATL-HPA074502) Datasheet (External Link) |
Vendor Page | Anti KLLN pAb (ATL-HPA074502) at Atlas |
Documents & Links for Anti KLLN pAb (ATL-HPA074502) | |
Datasheet | Anti KLLN pAb (ATL-HPA074502) Datasheet (External Link) |
Vendor Page | Anti KLLN pAb (ATL-HPA074502) |