Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)

Catalog No:
ATL-HPA062126-25
$303.00

Description

Product Description

Protein Description: kallikrein-related peptidase 7
Gene Name: KLK7
Alternative Gene Name: PRSS6, SCCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030713: 66%, ENSRNOG00000018664: 68%
Entrez Gene ID: 5650
Uniprot ID: P49862
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM
Gene Sequence AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM
Gene ID - Mouse ENSMUSG00000030713
Gene ID - Rat ENSRNOG00000018664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)
Datasheet Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)
Datasheet Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)

Citations

Citations for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed

Product Description

Protein Description: kallikrein-related peptidase 7
Gene Name: KLK7
Alternative Gene Name: PRSS6, SCCE
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000030713: 66%, ENSRNOG00000018664: 68%
Entrez Gene ID: 5650
Uniprot ID: P49862
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM
Gene Sequence AHCKMNEYTVHLGSDTLGDRRAQRIKASKSFRHPGYSTQTHVNDLMLVKLNSQARLSSM
Gene ID - Mouse ENSMUSG00000030713
Gene ID - Rat ENSRNOG00000018664
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)
Datasheet Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)
Datasheet Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation)

Citations

Citations for Anti KLK7 pAb (ATL-HPA062126 w/enhanced validation) – 1 Found
Månberg, Anna; Bradley, Frideborg; Qundos, Ulrika; Guthrie, Brandon L; Birse, Kenzie; Noël-Romas, Laura; Lindskog, Cecilia; Bosire, Rose; Kiarie, James; Farquhar, Carey; Burgener, Adam D; Nilsson, Peter; Broliden, Kristina. A High-throughput Bead-based Affinity Assay Enables Analysis of Genital Protein Signatures in Women At Risk of HIV Infection. Molecular & Cellular Proteomics : Mcp. 2019;18(3):461-476.  PubMed