Protein Description: kelch-like family member 15
Gene Name: KLHL15
Alternative Gene Name: KIAA1677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043929: 100%, ENSRNOG00000006515: 100%
Entrez Gene ID: 80311
Uniprot ID: Q96M94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLHL15
Alternative Gene Name: KIAA1677
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000043929: 100%, ENSRNOG00000006515: 100%
Entrez Gene ID: 80311
Uniprot ID: Q96M94
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | DQWTILASMPIGRSGHGVTVLDKQIMVLGGLCYNGHYSDSILTFDPDENKWKEDEYPRMPCKLDGLQVCNLHFPDYVLDEVRRCN |
| Documents & Links for Anti KLHL15 pAb (ATL-HPA065730) | |
| Datasheet | Anti KLHL15 pAb (ATL-HPA065730) Datasheet (External Link) |
| Vendor Page | Anti KLHL15 pAb (ATL-HPA065730) at Atlas |
| Documents & Links for Anti KLHL15 pAb (ATL-HPA065730) | |
| Datasheet | Anti KLHL15 pAb (ATL-HPA065730) Datasheet (External Link) |
| Vendor Page | Anti KLHL15 pAb (ATL-HPA065730) |