Protein Description: kelch-like family member 10
Gene Name: KLHL10
Alternative Gene Name: FLJ32662
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001558: 100%, ENSRNOG00000016749: 100%
Entrez Gene ID: 317719
Uniprot ID: Q6JEL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLHL10
Alternative Gene Name: FLJ32662
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001558: 100%, ENSRNOG00000016749: 100%
Entrez Gene ID: 317719
Uniprot ID: Q6JEL2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AVGGFDGANRLRSAEAYSPVANTWRTIPTMFNPRSNFGIEVVDDLLFVVGGFNGFTTTFNVECYDEKTDEWYDAHDMSIYRSALSCCVVPGLA |
| Documents & Links for Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) | |
| Datasheet | Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) at Atlas |
| Documents & Links for Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) | |
| Datasheet | Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KLHL10 pAb (ATL-HPA067538 w/enhanced validation) |