Anti KLHDC7B pAb (ATL-HPA076540)

Catalog No:
ATL-HPA076540-25
$447.00

Description

Product Description

Protein Description: kelch domain containing 7B
Gene Name: KLHDC7B
Alternative Gene Name: MGC16635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091680: 85%, ENSRNOG00000032419: 86%
Entrez Gene ID: 113730
Uniprot ID: Q96G42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS
Gene Sequence AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS
Gene ID - Mouse ENSMUSG00000091680
Gene ID - Rat ENSRNOG00000032419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540)
Datasheet Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link)
Vendor Page Anti KLHDC7B pAb (ATL-HPA076540) at Atlas Antibodies

Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540)
Datasheet Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link)
Vendor Page Anti KLHDC7B pAb (ATL-HPA076540)

Product Description

Protein Description: kelch domain containing 7B
Gene Name: KLHDC7B
Alternative Gene Name: MGC16635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091680: 85%, ENSRNOG00000032419: 86%
Entrez Gene ID: 113730
Uniprot ID: Q96G42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS
Gene Sequence AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS
Gene ID - Mouse ENSMUSG00000091680
Gene ID - Rat ENSRNOG00000032419
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540)
Datasheet Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link)
Vendor Page Anti KLHDC7B pAb (ATL-HPA076540) at Atlas Antibodies

Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540)
Datasheet Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link)
Vendor Page Anti KLHDC7B pAb (ATL-HPA076540)