Protein Description: kelch domain containing 7B
Gene Name: KLHDC7B
Alternative Gene Name: MGC16635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091680: 85%, ENSRNOG00000032419: 86%
Entrez Gene ID: 113730
Uniprot ID: Q96G42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLHDC7B
Alternative Gene Name: MGC16635
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000091680: 85%, ENSRNOG00000032419: 86%
Entrez Gene ID: 113730
Uniprot ID: Q96G42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | AAVMRYNTVTGSWSRAASLPLPAPAPLHCTTLGNTIYCLNPQVTATFTVSGGTAQFQAKELQPFPLGSTGVLSPFILTLPPEDRLQTS |
| Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540) | |
| Datasheet | Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link) |
| Vendor Page | Anti KLHDC7B pAb (ATL-HPA076540) at Atlas |
| Documents & Links for Anti KLHDC7B pAb (ATL-HPA076540) | |
| Datasheet | Anti KLHDC7B pAb (ATL-HPA076540) Datasheet (External Link) |
| Vendor Page | Anti KLHDC7B pAb (ATL-HPA076540) |