Protein Description: Kruppel-like factor 6
Gene Name: KLF6
Alternative Gene Name: BCD1, COPEB, CPBP, GBF, PAC1, ST12, Zf9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000078: 89%, ENSRNOG00000016885: 88%
Entrez Gene ID: 1316
Uniprot ID: Q99612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLF6
Alternative Gene Name: BCD1, COPEB, CPBP, GBF, PAC1, ST12, Zf9
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000000078: 89%, ENSRNOG00000016885: 88%
Entrez Gene ID: 1316
Uniprot ID: Q99612
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN |
Documents & Links for Anti KLF6 pAb (ATL-HPA069585) | |
Datasheet | Anti KLF6 pAb (ATL-HPA069585) Datasheet (External Link) |
Vendor Page | Anti KLF6 pAb (ATL-HPA069585) at Atlas |
Documents & Links for Anti KLF6 pAb (ATL-HPA069585) | |
Datasheet | Anti KLF6 pAb (ATL-HPA069585) Datasheet (External Link) |
Vendor Page | Anti KLF6 pAb (ATL-HPA069585) |