Protein Description: Kruppel-like factor 3 (basic)
Gene Name: KLF3
Alternative Gene Name: BKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029178: 92%, ENSRNOG00000002163: 94%
Entrez Gene ID: 51274
Uniprot ID: P57682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLF3
Alternative Gene Name: BKLF
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029178: 92%, ENSRNOG00000002163: 94%
Entrez Gene ID: 51274
Uniprot ID: P57682
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | LMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQMEPVDL |
Documents & Links for Anti KLF3 pAb (ATL-HPA065054) | |
Datasheet | Anti KLF3 pAb (ATL-HPA065054) Datasheet (External Link) |
Vendor Page | Anti KLF3 pAb (ATL-HPA065054) at Atlas |
Documents & Links for Anti KLF3 pAb (ATL-HPA065054) | |
Datasheet | Anti KLF3 pAb (ATL-HPA065054) Datasheet (External Link) |
Vendor Page | Anti KLF3 pAb (ATL-HPA065054) |