Protein Description: Kruppel like factor 12
Gene Name: KLF12
Alternative Gene Name: AP-2rep, AP2REP, HSPC122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072294: 99%, ENSRNOG00000009145: 98%
Entrez Gene ID: 11278
Uniprot ID: Q9Y4X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KLF12
Alternative Gene Name: AP-2rep, AP2REP, HSPC122
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000072294: 99%, ENSRNOG00000009145: 98%
Entrez Gene ID: 11278
Uniprot ID: Q9Y4X4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SSPTVITSVSSASSSSTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNKLSHVHRIPVVVQSVPVVYTAVRSPGNV |
Documents & Links for Anti KLF12 pAb (ATL-HPA075652) | |
Datasheet | Anti KLF12 pAb (ATL-HPA075652) Datasheet (External Link) |
Vendor Page | Anti KLF12 pAb (ATL-HPA075652) at Atlas |
Documents & Links for Anti KLF12 pAb (ATL-HPA075652) | |
Datasheet | Anti KLF12 pAb (ATL-HPA075652) Datasheet (External Link) |
Vendor Page | Anti KLF12 pAb (ATL-HPA075652) |