Protein Description: v-kit Hardy-Zuckerman 4 feline sarcoma viral oncogene homolog
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 88%, ENSRNOG00000002227: 89%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIT
Alternative Gene Name: C-Kit, CD117, PBT, SCFR
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000005672: 88%, ENSRNOG00000002227: 89%
Entrez Gene ID: 3815
Uniprot ID: P10721
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | RKRDSFICSKQEDHAEAALYKNLLHSKESSCSDSTNEYMDMKPGVSYVVPTKADKRRSVRIGSYIERDVTPAIMEDDELAL |
| Documents & Links for Anti KIT pAb (ATL-HPA073252) | |
| Datasheet | Anti KIT pAb (ATL-HPA073252) Datasheet (External Link) |
| Vendor Page | Anti KIT pAb (ATL-HPA073252) at Atlas |
| Documents & Links for Anti KIT pAb (ATL-HPA073252) | |
| Datasheet | Anti KIT pAb (ATL-HPA073252) Datasheet (External Link) |
| Vendor Page | Anti KIT pAb (ATL-HPA073252) |