Protein Description: kin of IRRE like 2 (Drosophila)
Gene Name: KIRREL2
Alternative Gene Name: DKFZp564A1164, FILTRIN, MGC15718, NEPH3, NLG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036915: 91%, ENSRNOG00000020864: 90%
Entrez Gene ID: 84063
Uniprot ID: Q6UWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIRREL2
Alternative Gene Name: DKFZp564A1164, FILTRIN, MGC15718, NEPH3, NLG1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036915: 91%, ENSRNOG00000020864: 90%
Entrez Gene ID: 84063
Uniprot ID: Q6UWL6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EVTLSASPHTVQEGEKVIFLCQATAQPPVTGYRWAKGGSPVLGARGPRLEVVADASFL |
| Documents & Links for Anti KIRREL2 pAb (ATL-HPA074326) | |
| Datasheet | Anti KIRREL2 pAb (ATL-HPA074326) Datasheet (External Link) |
| Vendor Page | Anti KIRREL2 pAb (ATL-HPA074326) at Atlas |
| Documents & Links for Anti KIRREL2 pAb (ATL-HPA074326) | |
| Datasheet | Anti KIRREL2 pAb (ATL-HPA074326) Datasheet (External Link) |
| Vendor Page | Anti KIRREL2 pAb (ATL-HPA074326) |