Description
Product Description
Protein Description: kinesin family member 2C
Gene Name: KIF2C
Alternative Gene Name: CT139, KNSL6, MCAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028678: 81%, ENSRNOG00000019100: 83%
Entrez Gene ID: 11004
Uniprot ID: Q99661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIF2C
Alternative Gene Name: CT139, KNSL6, MCAK
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028678: 81%, ENSRNOG00000019100: 83%
Entrez Gene ID: 11004
Uniprot ID: Q99661
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK |
Gene Sequence | MDSSLQARLFPGLAIKIQRSNGLIHSANVRTVNLEKSCVSVEWAEGGATKGKEIDFDDVAAINPELLQLLPLHPKDNLPLQENVTIQK |
Gene ID - Mouse | ENSMUSG00000028678 |
Gene ID - Rat | ENSRNOG00000019100 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) | |
Datasheet | Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) at Atlas Antibodies |
Documents & Links for Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) | |
Datasheet | Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KIF2C pAb (ATL-HPA079172 w/enhanced validation) |