Description
Product Description
Protein Description: kinesin family member 23
Gene Name: KIF23
Alternative Gene Name: KNSL5, MKLP-1, MKLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032254: 91%, ENSRNOG00000014080: 82%
Entrez Gene ID: 9493
Uniprot ID: Q02241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIF23
Alternative Gene Name: KNSL5, MKLP-1, MKLP1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000032254: 91%, ENSRNOG00000014080: 82%
Entrez Gene ID: 9493
Uniprot ID: Q02241
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL |
Gene Sequence | APPIRLRHRRSRSAGDRWVDHKPASNMQTETVMQPHVPHAITVSVANEKALAKCEKYMLTHQELASDGEIETKLIKGDIYKTRGGGQSVQFTDIETL |
Gene ID - Mouse | ENSMUSG00000032254 |
Gene ID - Rat | ENSRNOG00000014080 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIF23 pAb (ATL-HPA068831) | |
Datasheet | Anti KIF23 pAb (ATL-HPA068831) Datasheet (External Link) |
Vendor Page | Anti KIF23 pAb (ATL-HPA068831) at Atlas Antibodies |
Documents & Links for Anti KIF23 pAb (ATL-HPA068831) | |
Datasheet | Anti KIF23 pAb (ATL-HPA068831) Datasheet (External Link) |
Vendor Page | Anti KIF23 pAb (ATL-HPA068831) |