Protein Description: kinesin family member 19
Gene Name: KIF19
Alternative Gene Name: FLJ37300, KIF19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010021: 99%, ENSRNOG00000003105: 99%
Entrez Gene ID: 124602
Uniprot ID: Q2TAC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIF19
Alternative Gene Name: FLJ37300, KIF19A
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000010021: 99%, ENSRNOG00000003105: 99%
Entrez Gene ID: 124602
Uniprot ID: Q2TAC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SGDSKDQQLMVALRVRPISVAELEEGATLIAHKVDEQMVVLMDPMEDPDDILRAHRSREKSYLFDVAFDFTATQEMVYQ |
| Documents & Links for Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) | |
| Datasheet | Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) at Atlas |
| Documents & Links for Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) | |
| Datasheet | Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIF19 pAb (ATL-HPA073303 w/enhanced validation) |