Protein Description: KIAA2012
Gene Name: KIAA2012
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047361: 31%, ENSRNOG00000022723: 42%
Entrez Gene ID: 100652824
Uniprot ID: Q0VF49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA2012
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047361: 31%, ENSRNOG00000022723: 42%
Entrez Gene ID: 100652824
Uniprot ID: Q0VF49
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | THHNDQDPEPRSMTLDSPRASRTEHIQTPEADIVQKVGRDYDVHHLHRGLLGYGPESPERLSAVYTSLLPREREGKAEPRLFS |
| Gene ID - Mouse | ENSMUSG00000047361 |
| Gene ID - Rat | ENSMUSG00000047361 |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
| Documents & Links for Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) | |
| Datasheet | Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) at Atlas |
| Documents & Links for Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) | |
| Datasheet | Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KIAA2012 pAb (ATL-HPA077834 w/enhanced validation) |