Anti KIAA1614 pAb (ATL-HPA061684)

Catalog No:
ATL-HPA061684-100
$596.00

Description

Product Description

Protein Description: KIAA1614
Gene Name: KIAA1614
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033722: 58%, ENSRNOG00000000040: 58%
Entrez Gene ID: 57710
Uniprot ID: Q5VZ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ
Gene Sequence PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ
Gene ID - Mouse ENSMUSG00000033722
Gene ID - Rat ENSRNOG00000000040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684)
Datasheet Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link)
Vendor Page Anti KIAA1614 pAb (ATL-HPA061684) at Atlas Antibodies

Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684)
Datasheet Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link)
Vendor Page Anti KIAA1614 pAb (ATL-HPA061684)

Product Description

Protein Description: KIAA1614
Gene Name: KIAA1614
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033722: 58%, ENSRNOG00000000040: 58%
Entrez Gene ID: 57710
Uniprot ID: Q5VZ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application WB, ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ
Gene Sequence PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ
Gene ID - Mouse ENSMUSG00000033722
Gene ID - Rat ENSRNOG00000000040
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684)
Datasheet Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link)
Vendor Page Anti KIAA1614 pAb (ATL-HPA061684) at Atlas Antibodies

Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684)
Datasheet Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link)
Vendor Page Anti KIAA1614 pAb (ATL-HPA061684)