Description
Product Description
Protein Description: KIAA1614
Gene Name: KIAA1614
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033722: 58%, ENSRNOG00000000040: 58%
Entrez Gene ID: 57710
Uniprot ID: Q5VZ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA1614
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033722: 58%, ENSRNOG00000000040: 58%
Entrez Gene ID: 57710
Uniprot ID: Q5VZ46
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | WB, ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ |
Gene Sequence | PGHCNKIIHIPSPRTGRSYPFPDGVVTEADLDSTSLTSEEVFVPRTALLGERWRAGDLEALGAGSSVLSLSDRVERNRLLLQEMLNVSGQ |
Gene ID - Mouse | ENSMUSG00000033722 |
Gene ID - Rat | ENSRNOG00000000040 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684) | |
Datasheet | Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link) |
Vendor Page | Anti KIAA1614 pAb (ATL-HPA061684) at Atlas Antibodies |
Documents & Links for Anti KIAA1614 pAb (ATL-HPA061684) | |
Datasheet | Anti KIAA1614 pAb (ATL-HPA061684) Datasheet (External Link) |
Vendor Page | Anti KIAA1614 pAb (ATL-HPA061684) |