Description
Product Description
Protein Description: KIAA1522
Gene Name: KIAA1522
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050390: 83%, ENSRNOG00000008113: 85%
Entrez Gene ID: 57648
Uniprot ID: Q9P206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA1522
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000050390: 83%, ENSRNOG00000008113: 85%
Entrez Gene ID: 57648
Uniprot ID: Q9P206
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | SAKAENDKHLSVGPGQGPGSAVDEHQDNVFFPSGRPPHLEELHTQAQEGLRSLQHQEKQKLNKGGWDHGDTQSIQSSR |
Gene Sequence | SAKAENDKHLSVGPGQGPGSAVDEHQDNVFFPSGRPPHLEELHTQAQEGLRSLQHQEKQKLNKGGWDHGDTQSIQSSR |
Gene ID - Mouse | ENSMUSG00000050390 |
Gene ID - Rat | ENSRNOG00000008113 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA1522 pAb (ATL-HPA064839) | |
Datasheet | Anti KIAA1522 pAb (ATL-HPA064839) Datasheet (External Link) |
Vendor Page | Anti KIAA1522 pAb (ATL-HPA064839) at Atlas Antibodies |
Documents & Links for Anti KIAA1522 pAb (ATL-HPA064839) | |
Datasheet | Anti KIAA1522 pAb (ATL-HPA064839) Datasheet (External Link) |
Vendor Page | Anti KIAA1522 pAb (ATL-HPA064839) |