Anti KIAA1324L pAb (ATL-HPA076093)

Catalog No:
ATL-HPA076093-25
$303.00

Description

Product Description

Protein Description: KIAA1324-like
Gene Name: KIAA1324L
Alternative Gene Name: EIG121L, FLJ31340
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056004: 90%, ENSRNOG00000005818: 89%
Entrez Gene ID: 222223
Uniprot ID: A8MWY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT
Gene Sequence YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT
Gene ID - Mouse ENSMUSG00000056004
Gene ID - Rat ENSRNOG00000005818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093)
Datasheet Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link)
Vendor Page Anti KIAA1324L pAb (ATL-HPA076093) at Atlas Antibodies

Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093)
Datasheet Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link)
Vendor Page Anti KIAA1324L pAb (ATL-HPA076093)

Product Description

Protein Description: KIAA1324-like
Gene Name: KIAA1324L
Alternative Gene Name: EIG121L, FLJ31340
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056004: 90%, ENSRNOG00000005818: 89%
Entrez Gene ID: 222223
Uniprot ID: A8MWY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT
Gene Sequence YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT
Gene ID - Mouse ENSMUSG00000056004
Gene ID - Rat ENSRNOG00000005818
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093)
Datasheet Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link)
Vendor Page Anti KIAA1324L pAb (ATL-HPA076093) at Atlas Antibodies

Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093)
Datasheet Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link)
Vendor Page Anti KIAA1324L pAb (ATL-HPA076093)