Protein Description: KIAA1324-like
Gene Name: KIAA1324L
Alternative Gene Name: EIG121L, FLJ31340
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056004: 90%, ENSRNOG00000005818: 89%
Entrez Gene ID: 222223
Uniprot ID: A8MWY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA1324L
Alternative Gene Name: EIG121L, FLJ31340
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000056004: 90%, ENSRNOG00000005818: 89%
Entrez Gene ID: 222223
Uniprot ID: A8MWY0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YFHFFNISLCGHEGKKMALCTNNITDFTVKEIVAGSDDYTNLVGAFVCQSTIIPSESKGFRAALSSQSIILADTFIGVTVETT |
| Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093) | |
| Datasheet | Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link) |
| Vendor Page | Anti KIAA1324L pAb (ATL-HPA076093) at Atlas |
| Documents & Links for Anti KIAA1324L pAb (ATL-HPA076093) | |
| Datasheet | Anti KIAA1324L pAb (ATL-HPA076093) Datasheet (External Link) |
| Vendor Page | Anti KIAA1324L pAb (ATL-HPA076093) |