Anti KIAA1324 pAb (ATL-HPA070749 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA070749-25

• 
• 

Product Description

Protein Description: KIAA1324
Gene Name: KIAA1324
Alternative Gene Name: EIG121, maba1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000040412: 93%, ENSRNOG00000020272: 93%
Entrez Gene ID: 57535
Uniprot ID: Q6UXG2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC, IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSI
• Gene Sequence: ELPHGFASLSANMELDDSAAESTGNCTSSKWVPRGDYIASNTDECTATLMYAVNLKQSGTVNFEYYYPDSSI
• Gene ID - Mouse: ENSMUSG00000040412
• Gene ID - Rat: ENSRNOG00000020272
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.