Description
Product Description
Protein Description: KIAA1147
Gene Name: KIAA1147
Alternative Gene Name: LCHN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037172: 100%, ENSRNOG00000011854: 99%
Entrez Gene ID: 57189
Uniprot ID: A4D1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA1147
Alternative Gene Name: LCHN
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037172: 100%, ENSRNOG00000011854: 99%
Entrez Gene ID: 57189
Uniprot ID: A4D1U4
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL |
Gene Sequence | FYVNVADIESLEVEVSYVACTTEKIFEEKRELYDVYVDNQNVKTHHDHLQPLLKINSADREKYRRLNEQRQMLL |
Gene ID - Mouse | ENSMUSG00000037172 |
Gene ID - Rat | ENSRNOG00000011854 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437) | |
Datasheet | Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link) |
Vendor Page | Anti KIAA1147 pAb (ATL-HPA061437) at Atlas Antibodies |
Documents & Links for Anti KIAA1147 pAb (ATL-HPA061437) | |
Datasheet | Anti KIAA1147 pAb (ATL-HPA061437) Datasheet (External Link) |
Vendor Page | Anti KIAA1147 pAb (ATL-HPA061437) |