Description
Product Description
Protein Description: KIAA0895-like
Gene Name: KIAA0895L
Alternative Gene Name: LOC653319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014837: 88%, ENSRNOG00000015625: 88%
Entrez Gene ID: 653319
Uniprot ID: Q68EN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA0895L
Alternative Gene Name: LOC653319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014837: 88%, ENSRNOG00000015625: 88%
Entrez Gene ID: 653319
Uniprot ID: Q68EN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD |
Gene Sequence | EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD |
Gene ID - Mouse | ENSMUSG00000014837 |
Gene ID - Rat | ENSRNOG00000015625 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996) | |
Datasheet | Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link) |
Vendor Page | Anti KIAA0895L pAb (ATL-HPA065996) at Atlas Antibodies |
Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996) | |
Datasheet | Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link) |
Vendor Page | Anti KIAA0895L pAb (ATL-HPA065996) |