Anti KIAA0895L pAb (ATL-HPA065996)

Catalog No:
ATL-HPA065996-25
$303.00

Description

Product Description

Protein Description: KIAA0895-like
Gene Name: KIAA0895L
Alternative Gene Name: LOC653319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014837: 88%, ENSRNOG00000015625: 88%
Entrez Gene ID: 653319
Uniprot ID: Q68EN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD
Gene Sequence EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD
Gene ID - Mouse ENSMUSG00000014837
Gene ID - Rat ENSRNOG00000015625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996)
Datasheet Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link)
Vendor Page Anti KIAA0895L pAb (ATL-HPA065996) at Atlas Antibodies

Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996)
Datasheet Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link)
Vendor Page Anti KIAA0895L pAb (ATL-HPA065996)

Product Description

Protein Description: KIAA0895-like
Gene Name: KIAA0895L
Alternative Gene Name: LOC653319
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000014837: 88%, ENSRNOG00000015625: 88%
Entrez Gene ID: 653319
Uniprot ID: Q68EN5
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD
Gene Sequence EDVDHLRPHGVLDNTRVPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD
Gene ID - Mouse ENSMUSG00000014837
Gene ID - Rat ENSRNOG00000015625
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996)
Datasheet Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link)
Vendor Page Anti KIAA0895L pAb (ATL-HPA065996) at Atlas Antibodies

Documents & Links for Anti KIAA0895L pAb (ATL-HPA065996)
Datasheet Anti KIAA0895L pAb (ATL-HPA065996) Datasheet (External Link)
Vendor Page Anti KIAA0895L pAb (ATL-HPA065996)