Description
Product Description
Protein Description: KIAA0895
Gene Name: KIAA0895
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036411: 75%, ENSRNOG00000026979: 75%
Entrez Gene ID: 23366
Uniprot ID: Q8NCT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA0895
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036411: 75%, ENSRNOG00000026979: 75%
Entrez Gene ID: 23366
Uniprot ID: Q8NCT3
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KLHWPEQELAKKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKYHSQKQSSSTYSKRCRKPSKSPNTSRSKDP |
Gene Sequence | KLHWPEQELAKKSILNAEDSLIIDNKRSISHLSSGVLKDIFTTGTSSYNVLLQSKEEKKYHSQKQSSSTYSKRCRKPSKSPNTSRSKDP |
Gene ID - Mouse | ENSMUSG00000036411 |
Gene ID - Rat | ENSRNOG00000026979 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA0895 pAb (ATL-HPA061066) | |
Datasheet | Anti KIAA0895 pAb (ATL-HPA061066) Datasheet (External Link) |
Vendor Page | Anti KIAA0895 pAb (ATL-HPA061066) at Atlas Antibodies |
Documents & Links for Anti KIAA0895 pAb (ATL-HPA061066) | |
Datasheet | Anti KIAA0895 pAb (ATL-HPA061066) Datasheet (External Link) |
Vendor Page | Anti KIAA0895 pAb (ATL-HPA061066) |