Description
Product Description
Protein Description: KIAA0232
Gene Name: KIAA0232
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029190: 94%, ENSRNOG00000027623: 94%
Entrez Gene ID: 9778
Uniprot ID: Q92628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KIAA0232
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000029190: 94%, ENSRNOG00000027623: 94%
Entrez Gene ID: 9778
Uniprot ID: Q92628
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI |
Gene Sequence | ESVHGLCISNNNLHKTYLAAGTFIDGHFVEMPAVINEDIDLTGTSLCSLPEDNKYLDDIHLSELTHFYEVDIDQSMLDPGASETMQGESRILNMI |
Gene ID - Mouse | ENSMUSG00000029190 |
Gene ID - Rat | ENSRNOG00000027623 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KIAA0232 pAb (ATL-HPA061498) | |
Datasheet | Anti KIAA0232 pAb (ATL-HPA061498) Datasheet (External Link) |
Vendor Page | Anti KIAA0232 pAb (ATL-HPA061498) at Atlas Antibodies |
Documents & Links for Anti KIAA0232 pAb (ATL-HPA061498) | |
Datasheet | Anti KIAA0232 pAb (ATL-HPA061498) Datasheet (External Link) |
Vendor Page | Anti KIAA0232 pAb (ATL-HPA061498) |