Anti KDM4C pAb (ATL-HPA069357)

Atlas Antibodies

Catalog No: ATL-HPA069357-25

• 

Product Description

Protein Description: lysine (K)-specific demethylase 4C
Gene Name: KDM4C
Alternative Gene Name: GASC1, JMJD2C, KIAA0780, TDRD14C
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000028397: 95%, ENSRNOG00000006644: 95%
Entrez Gene ID: 23081
Uniprot ID: Q9H3R0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
• Gene Sequence: ARFSTASDMRFEDTFYGADIIQGERKRQRVLSSRFKNEYVADPVYRTFLKSSFQKKCQK
• Gene ID - Mouse: ENSMUSG00000028397
• Gene ID - Rat: ENSRNOG00000006644
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.