Description
Product Description
Protein Description: lysine (K)-specific demethylase 3B
Gene Name: KDM3B
Alternative Gene Name: C5orf7, JMJD1B, KIAA1082, NET22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038773: 93%, ENSRNOG00000050200: 93%
Entrez Gene ID: 51780
Uniprot ID: Q7LBC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDM3B
Alternative Gene Name: C5orf7, JMJD1B, KIAA1082, NET22
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000038773: 93%, ENSRNOG00000050200: 93%
Entrez Gene ID: 51780
Uniprot ID: Q7LBC6
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST |
Gene Sequence | TLSSSPTEERPTVGPGQQDNPLLKTFSNVFGRHSGGFLSSPADFSQENKAPFEAVKRFSLDERSLACRQDSDSST |
Gene ID - Mouse | ENSMUSG00000038773 |
Gene ID - Rat | ENSRNOG00000050200 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KDM3B pAb (ATL-HPA057202) | |
Datasheet | Anti KDM3B pAb (ATL-HPA057202) Datasheet (External Link) |
Vendor Page | Anti KDM3B pAb (ATL-HPA057202) at Atlas Antibodies |
Documents & Links for Anti KDM3B pAb (ATL-HPA057202) | |
Datasheet | Anti KDM3B pAb (ATL-HPA057202) Datasheet (External Link) |
Vendor Page | Anti KDM3B pAb (ATL-HPA057202) |