Description
Product Description
Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL |
Gene Sequence | ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL |
Gene ID - Mouse | ENSMUSG00000037600 |
Gene ID - Rat | ENSRNOG00000058670 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KDF1 pAb (ATL-HPA068312) | |
Datasheet | Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link) |
Vendor Page | Anti KDF1 pAb (ATL-HPA068312) at Atlas Antibodies |
Documents & Links for Anti KDF1 pAb (ATL-HPA068312) | |
Datasheet | Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link) |
Vendor Page | Anti KDF1 pAb (ATL-HPA068312) |