Anti KDF1 pAb (ATL-HPA068312)

Catalog No:
ATL-HPA068312-25
$447.00

Description

Product Description

Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
Gene Sequence ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
Gene ID - Mouse ENSMUSG00000037600
Gene ID - Rat ENSRNOG00000058670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KDF1 pAb (ATL-HPA068312)
Datasheet Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link)
Vendor Page Anti KDF1 pAb (ATL-HPA068312) at Atlas Antibodies

Documents & Links for Anti KDF1 pAb (ATL-HPA068312)
Datasheet Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link)
Vendor Page Anti KDF1 pAb (ATL-HPA068312)

Product Description

Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
Gene Sequence ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL
Gene ID - Mouse ENSMUSG00000037600
Gene ID - Rat ENSRNOG00000058670
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KDF1 pAb (ATL-HPA068312)
Datasheet Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link)
Vendor Page Anti KDF1 pAb (ATL-HPA068312) at Atlas Antibodies

Documents & Links for Anti KDF1 pAb (ATL-HPA068312)
Datasheet Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link)
Vendor Page Anti KDF1 pAb (ATL-HPA068312)