Protein Description: keratinocyte differentiation factor 1
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDF1
Alternative Gene Name: C1orf172, FLJ34633, RP11-344H11.3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000037600: 88%, ENSRNOG00000058670: 90%
Entrez Gene ID: 126695
Uniprot ID: Q8NAX2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | ANWAKEHNGVPPSPDRAPPSRRDGQRLKSTMGSSFSYPDVKLKGIPVYPYPRATSPAPDADSCCKEPLADPPPMRHSL |
| Documents & Links for Anti KDF1 pAb (ATL-HPA068312) | |
| Datasheet | Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link) |
| Vendor Page | Anti KDF1 pAb (ATL-HPA068312) at Atlas |
| Documents & Links for Anti KDF1 pAb (ATL-HPA068312) | |
| Datasheet | Anti KDF1 pAb (ATL-HPA068312) Datasheet (External Link) |
| Vendor Page | Anti KDF1 pAb (ATL-HPA068312) |