Protein Description: KDEL (Lys-Asp-Glu-Leu) containing 2
Gene Name: KDELC2
Alternative Gene Name: MGC33424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034487: 83%, ENSRNOG00000007177: 81%
Entrez Gene ID: 143888
Uniprot ID: Q7Z4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDELC2
Alternative Gene Name: MGC33424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034487: 83%, ENSRNOG00000007177: 81%
Entrez Gene ID: 143888
Uniprot ID: Q7Z4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK |
| Documents & Links for Anti KDELC2 pAb (ATL-HPA066134) | |
| Datasheet | Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link) |
| Vendor Page | Anti KDELC2 pAb (ATL-HPA066134) at Atlas |
| Documents & Links for Anti KDELC2 pAb (ATL-HPA066134) | |
| Datasheet | Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link) |
| Vendor Page | Anti KDELC2 pAb (ATL-HPA066134) |