Description
Product Description
Protein Description: KDEL (Lys-Asp-Glu-Leu) containing 2
Gene Name: KDELC2
Alternative Gene Name: MGC33424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034487: 83%, ENSRNOG00000007177: 81%
Entrez Gene ID: 143888
Uniprot ID: Q7Z4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDELC2
Alternative Gene Name: MGC33424
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034487: 83%, ENSRNOG00000007177: 81%
Entrez Gene ID: 143888
Uniprot ID: Q7Z4H8
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK |
Gene Sequence | KEGQLMARDLLQPHRLYCYYYQVLQKYAERQSSKPEVRDGMELVPQPEDSTAICQCHRK |
Gene ID - Mouse | ENSMUSG00000034487 |
Gene ID - Rat | ENSRNOG00000007177 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KDELC2 pAb (ATL-HPA066134) | |
Datasheet | Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link) |
Vendor Page | Anti KDELC2 pAb (ATL-HPA066134) at Atlas Antibodies |
Documents & Links for Anti KDELC2 pAb (ATL-HPA066134) | |
Datasheet | Anti KDELC2 pAb (ATL-HPA066134) Datasheet (External Link) |
Vendor Page | Anti KDELC2 pAb (ATL-HPA066134) |