Protein Description: KDEL (Lys-Asp-Glu-Leu) containing 1
Gene Name: KDELC1
Alternative Gene Name: EP58, MGC5302
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026047: 92%, ENSRNOG00000011740: 92%
Entrez Gene ID: 79070
Uniprot ID: Q6UW63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KDELC1
Alternative Gene Name: EP58, MGC5302
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000026047: 92%, ENSRNOG00000011740: 92%
Entrez Gene ID: 79070
Uniprot ID: Q6UW63
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | HENCDCPLQDSAAWLREMNCPETIAQIQRDLAHFPAVDPEKIAVEIPKRFGQRQSLCHYTLKDNKVYIKTHGEHVG |
| Documents & Links for Anti KDELC1 pAb (ATL-HPA064398) | |
| Datasheet | Anti KDELC1 pAb (ATL-HPA064398) Datasheet (External Link) |
| Vendor Page | Anti KDELC1 pAb (ATL-HPA064398) at Atlas |
| Documents & Links for Anti KDELC1 pAb (ATL-HPA064398) | |
| Datasheet | Anti KDELC1 pAb (ATL-HPA064398) Datasheet (External Link) |
| Vendor Page | Anti KDELC1 pAb (ATL-HPA064398) |