Anti KCTD18 pAb (ATL-HPA058028)

Atlas Antibodies

Catalog No: ATL-HPA058028-25

• 

Product Description

Protein Description: potassium channel tetramerization domain containing 18
Gene Name: KCTD18
Alternative Gene Name: 6530404F10Rik, FLJ31322, FLJ37818
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054770: 99%, ENSRNOG00000027091: 97%
Entrez Gene ID: 130535
Uniprot ID: Q6PI47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK
• Gene Sequence: YPYSLSDHLANEMETYSLRSNIELKKALTDFCDSYGLVCNKPTVWVLHYLNTSGASCESRIIGVYATKTDGTDAIEK
• Gene ID - Mouse: ENSMUSG00000054770
• Gene ID - Rat: ENSRNOG00000027091
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.