Anti KCTD1 pAb (ATL-HPA062486)

Atlas Antibodies

Catalog No: ATL-HPA062486-25

• 

Product Description

Protein Description: potassium channel tetramerization domain containing 1
Gene Name: KCTD1
Alternative Gene Name: C18orf5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036225: 95%, ENSRNOG00000016467: 95%
Entrez Gene ID: 284252
Uniprot ID: Q719H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: ICC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
• Gene Sequence: LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
• Gene ID - Mouse: ENSMUSG00000036225
• Gene ID - Rat: ENSRNOG00000016467
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.