Anti KCTD1 pAb (ATL-HPA062486)

Catalog No:
ATL-HPA062486-25
$447.00

Description

Product Description

Protein Description: potassium channel tetramerization domain containing 1
Gene Name: KCTD1
Alternative Gene Name: C18orf5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036225: 95%, ENSRNOG00000016467: 95%
Entrez Gene ID: 284252
Uniprot ID: Q719H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Gene Sequence LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Gene ID - Mouse ENSMUSG00000036225
Gene ID - Rat ENSRNOG00000016467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCTD1 pAb (ATL-HPA062486)
Datasheet Anti KCTD1 pAb (ATL-HPA062486) Datasheet (External Link)
Vendor Page Anti KCTD1 pAb (ATL-HPA062486) at Atlas Antibodies

Documents & Links for Anti KCTD1 pAb (ATL-HPA062486)
Datasheet Anti KCTD1 pAb (ATL-HPA062486) Datasheet (External Link)
Vendor Page Anti KCTD1 pAb (ATL-HPA062486)

Product Description

Protein Description: potassium channel tetramerization domain containing 1
Gene Name: KCTD1
Alternative Gene Name: C18orf5
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036225: 95%, ENSRNOG00000016467: 95%
Entrez Gene ID: 284252
Uniprot ID: Q719H9
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Gene Sequence LGNTYILPKDSQVGPDVKSEAAPKRALYESVFGSGEICGPTSPKRLCIRPSEPVDAVVVVSVKHDPLPLLPEANGHRSTNSPT
Gene ID - Mouse ENSMUSG00000036225
Gene ID - Rat ENSRNOG00000016467
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCTD1 pAb (ATL-HPA062486)
Datasheet Anti KCTD1 pAb (ATL-HPA062486) Datasheet (External Link)
Vendor Page Anti KCTD1 pAb (ATL-HPA062486) at Atlas Antibodies

Documents & Links for Anti KCTD1 pAb (ATL-HPA062486)
Datasheet Anti KCTD1 pAb (ATL-HPA062486) Datasheet (External Link)
Vendor Page Anti KCTD1 pAb (ATL-HPA062486)