Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation)

Catalog No:
ATL-HPA072287-25
$447.00

Description

Product Description

Protein Description: potassium channel subfamily M regulatory beta subunit 4
Gene Name: KCNMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054934: 96%, ENSRNOG00000054458: 96%
Entrez Gene ID: 27345
Uniprot ID: Q86W47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV
Gene Sequence CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV
Gene ID - Mouse ENSMUSG00000054934
Gene ID - Rat ENSRNOG00000054458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation)
Datasheet Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation)

Product Description

Protein Description: potassium channel subfamily M regulatory beta subunit 4
Gene Name: KCNMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054934: 96%, ENSRNOG00000054458: 96%
Entrez Gene ID: 27345
Uniprot ID: Q86W47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC, IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV
Gene Sequence CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV
Gene ID - Mouse ENSMUSG00000054934
Gene ID - Rat ENSRNOG00000054458
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links


Documents & Links for Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation)
Datasheet Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation)