Protein Description: potassium channel subfamily M regulatory beta subunit 4
Gene Name: KCNMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054934: 96%, ENSRNOG00000054458: 96%
Entrez Gene ID: 27345
Uniprot ID: Q86W47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNMB4
Alternative Gene Name:
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000054934: 96%, ENSRNOG00000054458: 96%
Entrez Gene ID: 27345
Uniprot ID: Q86W47
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC, IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CWLSPALQDLQATEANCTVLSVQQIGEVFECTFTCGADCRGTSQYPCVQV |
Documents & Links for Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) | |
Datasheet | Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) at Atlas |
Documents & Links for Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) | |
Datasheet | Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KCNMB4 pAb (ATL-HPA072287 w/enhanced validation) |