Protein Description: potassium two pore domain channel subfamily K member 9
Gene Name: KCNK9
Alternative Gene Name: K2p9.1, TASK-3, TASK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036760: 88%, ENSRNOG00000009265: 88%
Entrez Gene ID: 51305
Uniprot ID: Q9NPC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNK9
Alternative Gene Name: K2p9.1, TASK-3, TASK3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000036760: 88%, ENSRNOG00000009265: 88%
Entrez Gene ID: 51305
Uniprot ID: Q9NPC2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | LESDHEMREEEKLKAEEIRIKGKYNISSEDYRQLELVILQSEP |
| Documents & Links for Anti KCNK9 pAb (ATL-HPA075842) | |
| Datasheet | Anti KCNK9 pAb (ATL-HPA075842) Datasheet (External Link) |
| Vendor Page | Anti KCNK9 pAb (ATL-HPA075842) at Atlas |
| Documents & Links for Anti KCNK9 pAb (ATL-HPA075842) | |
| Datasheet | Anti KCNK9 pAb (ATL-HPA075842) Datasheet (External Link) |
| Vendor Page | Anti KCNK9 pAb (ATL-HPA075842) |