Protein Description: potassium channel, two pore domain subfamily K, member 7
Gene Name: KCNK7
Alternative Gene Name: K2p7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024936: 75%, ENSRNOG00000020784: 75%
Entrez Gene ID: 10089
Uniprot ID: Q9Y2U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNK7
Alternative Gene Name: K2p7.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000024936: 75%, ENSRNOG00000020784: 75%
Entrez Gene ID: 10089
Uniprot ID: Q9Y2U2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | GPPACRLQAELRAELAAFQAEHRACLPPGALEELLGTALATQAHGVSTLGNSSEGRTWDL |
| Documents & Links for Anti KCNK7 pAb (ATL-HPA077577) | |
| Datasheet | Anti KCNK7 pAb (ATL-HPA077577) Datasheet (External Link) |
| Vendor Page | Anti KCNK7 pAb (ATL-HPA077577) at Atlas |
| Documents & Links for Anti KCNK7 pAb (ATL-HPA077577) | |
| Datasheet | Anti KCNK7 pAb (ATL-HPA077577) Datasheet (External Link) |
| Vendor Page | Anti KCNK7 pAb (ATL-HPA077577) |