Protein Description: potassium channel, subfamily K, member 1
Gene Name: KCNK1
Alternative Gene Name: DPK, K2p1.1, TWIK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033998: 73%, ENSRNOG00000019937: 82%
Entrez Gene ID: 3775
Uniprot ID: O00180
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNK1
Alternative Gene Name: DPK, K2p1.1, TWIK-1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000033998: 73%, ENSRNOG00000019937: 82%
Entrez Gene ID: 3775
Uniprot ID: O00180
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | ICC, IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | YVKKDKDEDQVHIIEHDQLSFSSITDQAAGMKEDQKQNEPFVATQSSACVDGPAN |
| Documents & Links for Anti KCNK1 pAb (ATL-HPA016049) | |
| Datasheet | Anti KCNK1 pAb (ATL-HPA016049) Datasheet (External Link) |
| Vendor Page | Anti KCNK1 pAb (ATL-HPA016049) at Atlas |
| Documents & Links for Anti KCNK1 pAb (ATL-HPA016049) | |
| Datasheet | Anti KCNK1 pAb (ATL-HPA016049) Datasheet (External Link) |
| Vendor Page | Anti KCNK1 pAb (ATL-HPA016049) |
| Citations for Anti KCNK1 pAb (ATL-HPA016049) – 1 Found |
| Zhao, Ke-Qing; Xiong, Guoxiang; Wilber, Morgan; Cohen, Noam A; Kreindler, James L. A role for two-pore K⁺ channels in modulating Na⁺ absorption and Cl⁻ secretion in normal human bronchial epithelial cells. American Journal Of Physiology. Lung Cellular And Molecular Physiology. 2012;302(1):L4-L12. PubMed |