Protein Description: potassium voltage-gated channel subfamily J member 10
Gene Name: KCNJ10
Alternative Gene Name: Kir1.2, Kir4.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044708: 100%, ENSRNOG00000007705: 97%
Entrez Gene ID: 3766
Uniprot ID: P78508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNJ10
Alternative Gene Name: Kir1.2, Kir4.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000044708: 100%, ENSRNOG00000007705: 97%
Entrez Gene ID: 3766
Uniprot ID: P78508
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | EFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV |
| Documents & Links for Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) | |
| Datasheet | Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) at Atlas |
| Documents & Links for Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) | |
| Datasheet | Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KCNJ10 pAb (ATL-HPA078302 w/enhanced validation) |