Protein Description: Kv channel interacting protein 3, calsenilin
Gene Name: KCNIP3
Alternative Gene Name: calsenilin, CSEN, DREAM, KCHIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079056: 94%, ENSRNOG00000014152: 94%
Entrez Gene ID: 30818
Uniprot ID: Q9Y2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNIP3
Alternative Gene Name: calsenilin, CSEN, DREAM, KCHIP3
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000079056: 94%, ENSRNOG00000014152: 94%
Entrez Gene ID: 30818
Uniprot ID: Q9Y2W7
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | SRQALMRCCLVKWILSSTAPQGSDSSDSELELSTVRHQPEGLDQLQAQTKF |
| Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797) | |
| Datasheet | Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link) |
| Vendor Page | Anti KCNIP3 pAb (ATL-HPA069797) at Atlas |
| Documents & Links for Anti KCNIP3 pAb (ATL-HPA069797) | |
| Datasheet | Anti KCNIP3 pAb (ATL-HPA069797) Datasheet (External Link) |
| Vendor Page | Anti KCNIP3 pAb (ATL-HPA069797) |