Anti KCNH8 pAb (ATL-HPA077537)

Catalog No:
ATL-HPA077537-25
$447.00

On sale now! 25% off. Add item to cart to see discounted price. Valid thru Mar 2025.

Protein Description: potassium voltage-gated channel subfamily H member 8
Gene Name: KCNH8
Alternative Gene Name: elk3, Kv12.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035580: 79%, ENSRNOG00000058626: 77%
Entrez Gene ID: 131096
Uniprot ID: Q96L42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence SEVTTLTQEVSQLGKDMRNVIQLLENVLSPQQPSRFCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWSVDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHL
Gene ID - Mouse ENSMUSG00000035580
Gene ID - Rat ENSMUSG00000035580
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti KCNH8 pAb (ATL-HPA077537)
Datasheet Anti KCNH8 pAb (ATL-HPA077537) Datasheet (External Link)
Vendor Page Anti KCNH8 pAb (ATL-HPA077537) at Atlas

Documents & Links for Anti KCNH8 pAb (ATL-HPA077537)
Datasheet Anti KCNH8 pAb (ATL-HPA077537) Datasheet (External Link)
Vendor Page Anti KCNH8 pAb (ATL-HPA077537)