Protein Description: potassium voltage-gated channel subfamily H member 8
Gene Name: KCNH8
Alternative Gene Name: elk3, Kv12.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035580: 79%, ENSRNOG00000058626: 77%
Entrez Gene ID: 131096
Uniprot ID: Q96L42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNH8
Alternative Gene Name: elk3, Kv12.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000035580: 79%, ENSRNOG00000058626: 77%
Entrez Gene ID: 131096
Uniprot ID: Q96L42
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SEVTTLTQEVSQLGKDMRNVIQLLENVLSPQQPSRFCSLHSTSVCPSRESLQTRTSWSAHQPCLHLQTGGAAYTQAQLCSSNITSDIWSVDPSSVGSSPQRTGAHEQNPADSELYHSPSLDYSPSHYQVVQEGHL |
Documents & Links for Anti KCNH8 pAb (ATL-HPA077537) | |
Datasheet | Anti KCNH8 pAb (ATL-HPA077537) Datasheet (External Link) |
Vendor Page | Anti KCNH8 pAb (ATL-HPA077537) at Atlas |
Documents & Links for Anti KCNH8 pAb (ATL-HPA077537) | |
Datasheet | Anti KCNH8 pAb (ATL-HPA077537) Datasheet (External Link) |
Vendor Page | Anti KCNH8 pAb (ATL-HPA077537) |