Anti KCNH6 pAb (ATL-HPA061704)

Atlas Antibodies

Catalog No: ATL-HPA061704-25

• 

Product Description

Protein Description: potassium voltage-gated channel subfamily H member 6
Gene Name: KCNH6
Alternative Gene Name: erg2, HERG2, Kv11.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000001901: 39%, ENSRNOG00000008078: 34%
Entrez Gene ID: 81033
Uniprot ID: Q9H252
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
• Gene Sequence: SGSPHELGPQFPSKGYSLLGPGSQNSMGAGPCAPGHPDAAPPLSISDASGLWPELLQEMPPRHSPQSPQED
• Gene ID - Mouse: ENSMUSG00000001901
• Gene ID - Rat: ENSRNOG00000008078
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.