Protein Description: potassium voltage-gated channel subfamily H member 5
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 95%, ENSRNOG00000009542: 94%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 95%, ENSRNOG00000009542: 94%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK |
Documents & Links for Anti KCNH5 pAb (ATL-HPA072351) | |
Datasheet | Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link) |
Vendor Page | Anti KCNH5 pAb (ATL-HPA072351) at Atlas |
Documents & Links for Anti KCNH5 pAb (ATL-HPA072351) | |
Datasheet | Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link) |
Vendor Page | Anti KCNH5 pAb (ATL-HPA072351) |