Anti KCNH5 pAb (ATL-HPA072351)

Catalog No:
ATL-HPA072351-25
$447.00

Description

Product Description

Protein Description: potassium voltage-gated channel subfamily H member 5
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 95%, ENSRNOG00000009542: 94%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Gene Sequence SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Gene ID - Mouse ENSMUSG00000034402
Gene ID - Rat ENSRNOG00000009542
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNH5 pAb (ATL-HPA072351)
Datasheet Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link)
Vendor Page Anti KCNH5 pAb (ATL-HPA072351) at Atlas Antibodies

Documents & Links for Anti KCNH5 pAb (ATL-HPA072351)
Datasheet Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link)
Vendor Page Anti KCNH5 pAb (ATL-HPA072351)

Product Description

Protein Description: potassium voltage-gated channel subfamily H member 5
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 95%, ENSRNOG00000009542: 94%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Gene Sequence SLKQNNRDAMELKPNGGADQKCLKVNSPIRMKNGNGKGWLRLKNNMGAHEEKKEDWNNVTKAESMGLLSEDPKSSDSENSVTK
Gene ID - Mouse ENSMUSG00000034402
Gene ID - Rat ENSRNOG00000009542
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNH5 pAb (ATL-HPA072351)
Datasheet Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link)
Vendor Page Anti KCNH5 pAb (ATL-HPA072351) at Atlas Antibodies

Documents & Links for Anti KCNH5 pAb (ATL-HPA072351)
Datasheet Anti KCNH5 pAb (ATL-HPA072351) Datasheet (External Link)
Vendor Page Anti KCNH5 pAb (ATL-HPA072351)