Description
Product Description
Protein Description: potassium voltage-gated channel, subfamily H (eag-related), member 5
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 100%, ENSRNOG00000009542: 100%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNH5
Alternative Gene Name: eag2, H-EAG2, Kv10.2
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000034402: 100%, ENSRNOG00000009542: 100%
Entrez Gene ID: 27133
Uniprot ID: Q8NCM2
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Immunogen | GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS |
Gene Sequence | GDYEVIDEVTNTIQIDSWLYQLALSIGTPYRYNTSAGIWEGGPSKDS |
Gene ID - Mouse | ENSMUSG00000034402 |
Gene ID - Rat | ENSRNOG00000009542 |
Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. |
Documents & Links
Documents & Links for Anti KCNH5 pAb (ATL-HPA030487) | |
Datasheet | Anti KCNH5 pAb (ATL-HPA030487) Datasheet (External Link) |
Vendor Page | Anti KCNH5 pAb (ATL-HPA030487) at Atlas Antibodies |
Documents & Links for Anti KCNH5 pAb (ATL-HPA030487) | |
Datasheet | Anti KCNH5 pAb (ATL-HPA030487) Datasheet (External Link) |
Vendor Page | Anti KCNH5 pAb (ATL-HPA030487) |
Citations
Citations for Anti KCNH5 pAb (ATL-HPA030487) – 1 Found |
Huang, Xi; Dubuc, Adrian M; Hashizume, Rintaro; Berg, Jim; He, Ye; Wang, Ji; Chiang, Chin; Cooper, Michael K; Northcott, Paul A; Taylor, Michael D; Barnes, Michael J; Tihan, Tarik; Chen, Justin; Hackett, Christopher S; Weiss, William A; James, C David; Rowitch, David H; Shuman, Marc A; Jan, Yuh Nung; Jan, Lily Yeh. Voltage-gated potassium channel EAG2 controls mitotic entry and tumor growth in medulloblastoma via regulating cell volume dynamics. Genes & Development. 2012;26(16):1780-96. PubMed |