Protein Description: potassium voltage-gated channel subfamily H member 1
Gene Name: KCNH1
Alternative Gene Name: eag, eag1, h-eag, Kv10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058248: 87%, ENSRNOG00000003841: 94%
Entrez Gene ID: 3756
Uniprot ID: O95259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNH1
Alternative Gene Name: eag, eag1, h-eag, Kv10.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000058248: 87%, ENSRNOG00000003841: 94%
Entrez Gene ID: 3756
Uniprot ID: O95259
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | PGSECLGPKGGGGDCAKRKSWARFKDACGKSEDWNKVSKAESMETLPERTKASGEATLKKTD |
Documents & Links for Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) | |
Datasheet | Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) at Atlas |
Documents & Links for Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) | |
Datasheet | Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) Datasheet (External Link) |
Vendor Page | Anti KCNH1 pAb (ATL-HPA076421 w/enhanced validation) |