Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)

Catalog No:
ATL-HPA062278-25
$447.00

Description

Product Description

Protein Description: potassium voltage-gated channel modifier subfamily F member 1
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 100%, ENSRNOG00000024310: 100%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
Gene Sequence PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
Gene ID - Mouse ENSMUSG00000051726
Gene ID - Rat ENSRNOG00000024310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)
Datasheet Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)
Datasheet Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)

Product Description

Protein Description: potassium voltage-gated channel modifier subfamily F member 1
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 100%, ENSRNOG00000024310: 100%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
Gene Sequence PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
Gene ID - Mouse ENSMUSG00000051726
Gene ID - Rat ENSRNOG00000024310
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)
Datasheet Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) at Atlas Antibodies

Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)
Datasheet Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link)
Vendor Page Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)