Protein Description: potassium voltage-gated channel modifier subfamily F member 1
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 100%, ENSRNOG00000024310: 100%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 100%, ENSRNOG00000024310: 100%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
| Product Specifications | |
| Application | IHC |
| Reactivity | Human |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene Sequence | PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA |
| Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) | |
| Datasheet | Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) at Atlas |
| Documents & Links for Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) | |
| Datasheet | Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) Datasheet (External Link) |
| Vendor Page | Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation) |