Anti KCNF1 pAb (ATL-HPA062278 w/enhanced validation)

Atlas Antibodies

Catalog No: ATL-HPA062278-25

• 

Product Description

Protein Description: potassium voltage-gated channel modifier subfamily F member 1
Gene Name: KCNF1
Alternative Gene Name: IK8, KCNF, kH1, Kv5.1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000051726: 100%, ENSRNOG00000024310: 100%
Entrez Gene ID: 3754
Uniprot ID: Q9H3M0
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

• Application: IHC
• Reactivity: Human
• Clonality: Polyclonal
• Host: Rabbit
• Immunogen: PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
• Gene Sequence: PICFKNEMDFWKVDLKFLDDCCKSHLSEKREELEEIARRVQLILDDLGVDA
• Gene ID - Mouse: ENSMUSG00000051726
• Gene ID - Rat: ENSRNOG00000024310
• Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.