Protein Description: potassium channel, voltage gated subfamily A regulatory beta subunit 3
Gene Name: KCNAB3
Alternative Gene Name: AKR6A9, KCNA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018470: 84%, ENSRNOG00000008480: 80%
Entrez Gene ID: 9196
Uniprot ID: O43448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNAB3
Alternative Gene Name: AKR6A9, KCNA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018470: 84%, ENSRNOG00000008480: 80%
Entrez Gene ID: 9196
Uniprot ID: O43448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | ICC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ |
Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993) | |
Datasheet | Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link) |
Vendor Page | Anti KCNAB3 pAb (ATL-HPA077993) at Atlas |
Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993) | |
Datasheet | Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link) |
Vendor Page | Anti KCNAB3 pAb (ATL-HPA077993) |