Anti KCNAB3 pAb (ATL-HPA077993)

Catalog No:
ATL-HPA077993-25
$303.00
Protein Description: potassium channel, voltage gated subfamily A regulatory beta subunit 3
Gene Name: KCNAB3
Alternative Gene Name: AKR6A9, KCNA3B
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000018470: 84%, ENSRNOG00000008480: 80%
Entrez Gene ID: 9196
Uniprot ID: O43448
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications
Application ICC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Gene Sequence CGLITSKYDGRVPDTCRASIKGYQWLKDKVQSEDGKKQQAKVMDLLPVAHQ
Gene ID - Mouse ENSMUSG00000018470
Gene ID - Rat ENSMUSG00000018470
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993)
Datasheet Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link)
Vendor Page Anti KCNAB3 pAb (ATL-HPA077993) at Atlas

Documents & Links for Anti KCNAB3 pAb (ATL-HPA077993)
Datasheet Anti KCNAB3 pAb (ATL-HPA077993) Datasheet (External Link)
Vendor Page Anti KCNAB3 pAb (ATL-HPA077993)