Anti KCNA1 pAb (ATL-HPA074471)

Catalog No:
ATL-HPA074471-25
$303.00

Description

Product Description

Protein Description: potassium voltage-gated channel subfamily A member 1
Gene Name: KCNA1
Alternative Gene Name: AEMK, HUK1, Kv1.1, MBK1, RBK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047976: 94%, ENSRNOG00000019750: 91%
Entrez Gene ID: 3736
Uniprot ID: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Gene Sequence QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Gene ID - Mouse ENSMUSG00000047976
Gene ID - Rat ENSRNOG00000019750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNA1 pAb (ATL-HPA074471)
Datasheet Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link)
Vendor Page Anti KCNA1 pAb (ATL-HPA074471) at Atlas Antibodies

Documents & Links for Anti KCNA1 pAb (ATL-HPA074471)
Datasheet Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link)
Vendor Page Anti KCNA1 pAb (ATL-HPA074471)

Product Description

Protein Description: potassium voltage-gated channel subfamily A member 1
Gene Name: KCNA1
Alternative Gene Name: AEMK, HUK1, Kv1.1, MBK1, RBK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047976: 94%, ENSRNOG00000019750: 91%
Entrez Gene ID: 3736
Uniprot ID: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

Product Specifications

Product Specifications
Application IHC
Reactivity Human
Clonality Polyclonal
Host Rabbit
Immunogen QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Gene Sequence QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD
Gene ID - Mouse ENSMUSG00000047976
Gene ID - Rat ENSRNOG00000019750
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.

Documents & Links

Documents & Links for Anti KCNA1 pAb (ATL-HPA074471)
Datasheet Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link)
Vendor Page Anti KCNA1 pAb (ATL-HPA074471) at Atlas Antibodies

Documents & Links for Anti KCNA1 pAb (ATL-HPA074471)
Datasheet Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link)
Vendor Page Anti KCNA1 pAb (ATL-HPA074471)