Protein Description: potassium voltage-gated channel subfamily A member 1
Gene Name: KCNA1
Alternative Gene Name: AEMK, HUK1, Kv1.1, MBK1, RBK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047976: 94%, ENSRNOG00000019750: 91%
Entrez Gene ID: 3736
Uniprot ID: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Gene Name: KCNA1
Alternative Gene Name: AEMK, HUK1, Kv1.1, MBK1, RBK1
Isotype: IgG
Interspecies mouse/rat: ENSMUSG00000047976: 94%, ENSRNOG00000019750: 91%
Entrez Gene ID: 3736
Uniprot ID: Q09470
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Storage Temperature: Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Product Specifications | |
Application | IHC |
Reactivity | Human |
Clonality | Polyclonal |
Host | Rabbit |
Gene Sequence | QLLHVSSPNLASDSDLSRRSSSTMSKSEYMEIEEDMNNSIAHYRQVNIRTANCTTANQNCVNKSKLLTD |
Documents & Links for Anti KCNA1 pAb (ATL-HPA074471) | |
Datasheet | Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link) |
Vendor Page | Anti KCNA1 pAb (ATL-HPA074471) at Atlas |
Documents & Links for Anti KCNA1 pAb (ATL-HPA074471) | |
Datasheet | Anti KCNA1 pAb (ATL-HPA074471) Datasheet (External Link) |
Vendor Page | Anti KCNA1 pAb (ATL-HPA074471) |